PDB entry 1ch6

View 1ch6 on RCSB PDB site
Description: crystal structure of bovine liver glutamate dehydrogenase complexed with GTP, nadh, and l-glutamic acid
Class: oxidoreductase
Keywords: glutamate dehydrogenase, allostery, abortive complex
Deposited on 1999-03-31, released 1999-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2001-01-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.19
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glutamate dehydrogenase)
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (Start-500)
      • conflict (199)
      • conflict (201)
      • conflict (220-221)
    Domains in SCOPe 2.07: d1ch6a1, d1ch6a2
  • Chain 'B':
    Compound: protein (glutamate dehydrogenase)
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (Start-500)
      • conflict (199)
      • conflict (201)
      • conflict (220-221)
  • Chain 'C':
    Compound: protein (glutamate dehydrogenase)
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (Start-500)
      • conflict (199)
      • conflict (201)
      • conflict (220-221)
  • Chain 'D':
    Compound: protein (glutamate dehydrogenase)
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (Start-500)
      • conflict (199)
      • conflict (201)
      • conflict (220-221)
  • Chain 'E':
    Compound: protein (glutamate dehydrogenase)
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (Start-500)
      • conflict (199)
      • conflict (201)
      • conflict (220-221)
    Domains in SCOPe 2.07: d1ch6e1, d1ch6e2
  • Chain 'F':
    Compound: protein (glutamate dehydrogenase)
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (Start-500)
      • conflict (199)
      • conflict (201)
      • conflict (220-221)
    Domains in SCOPe 2.07: d1ch6f1, d1ch6f2
  • Heterogens: GLU, NAD, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ch6A (A:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ch6A (A:)
    dpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtpgfgdk
    tfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgtilgfp
    kakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkiflerni
    mvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfrvyneagvtft
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ch6E (E:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ch6E (E:)
    dpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtpgfgdk
    tfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgtilgfp
    kakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkiflerni
    mvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfrvyneagvtft
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ch6F (F:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ch6F (F:)
    dpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtpgfgdk
    tfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgtilgfp
    kakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkiflerni
    mvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfrvyneagvtft