PDB entry 1ch4

View 1ch4 on RCSB PDB site
Description: module-substituted chimera hemoglobin beta-alpha (f133v)
Deposited on 1998-06-11, released 1999-04-27
The last revision prior to the SCOP 1.71 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ch4a_
  • Chain 'B':
    Domains in SCOP 1.71: d1ch4b_
  • Chain 'C':
    Domains in SCOP 1.71: d1ch4c_
  • Chain 'D':
    Domains in SCOP 1.71: d1ch4d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ch4A (A:)
    vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklrvdpvnfkllshcllvtlaahlpa
    eftpavhasldkvlasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ch4B (B:)
    vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklrvdpvnfkllshcllvtlaahlpa
    eftpavhasldkvlasvstvltskyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ch4C (C:)
    vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklrvdpvnfkllshcllvtlaahlpa
    eftpavhasldkvlasvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ch4D (D:)
    vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklrvdpvnfkllshcllvtlaahlpa
    eftpavhasldkvlasvstvltskyr