PDB entry 1ch4

View 1ch4 on RCSB PDB site
Description: module-substituted chimera hemoglobin beta-alpha (f133v)
Class: oxygen transport
Keywords: oxygen transport, chimera protein, respiratory protein, heme
Deposited on 1998-06-11, released 1999-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: module-substituted chimera hemoglobin beta-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CH4 (0-145)
    Domains in SCOPe 2.07: d1ch4a_
  • Chain 'B':
    Compound: module-substituted chimera hemoglobin beta-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CH4 (0-145)
    Domains in SCOPe 2.07: d1ch4b_
  • Chain 'C':
    Compound: module-substituted chimera hemoglobin beta-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CH4 (0-145)
    Domains in SCOPe 2.07: d1ch4c_
  • Chain 'D':
    Compound: module-substituted chimera hemoglobin beta-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CH4 (0-145)
    Domains in SCOPe 2.07: d1ch4d_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ch4A (A:)
    vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklrvdpvnfkllshcllvtlaahlpa
    eftpavhasldkvlasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ch4B (B:)
    vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklrvdpvnfkllshcllvtlaahlpa
    eftpavhasldkvlasvstvltskyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ch4C (C:)
    vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklrvdpvnfkllshcllvtlaahlpa
    eftpavhasldkvlasvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ch4D (D:)
    vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklrvdpvnfkllshcllvtlaahlpa
    eftpavhasldkvlasvstvltskyr