PDB entry 1ch1

View 1ch1 on RCSB PDB site
Description: Recombinant sperm whale myoglobin L89G mutatnt (MET)
Class: oxygen storage/transport
Keywords: oxygen transport, heme, muscle protein, oxygen storage/transport complex
Deposited on 1999-03-31, released 1999-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.163
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (myoglobin)
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered (89)
      • engineered (122)
    Domains in SCOPe 2.07: d1ch1a_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ch1A (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkpgaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg