PDB entry 1ch0

View 1ch0 on RCSB PDB site
Description: RNAse t1 variant with altered guanine binding segment
Class: hydrolase
Keywords: ribonuclease, hydrolase
Deposited on 1999-03-30, released 1999-12-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribonuclease t1)
    Species: Aspergillus oryzae, synthetic [TaxId:5062]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00651 (0-103)
      • see remark 999 (24)
      • random mutagenesis (40-42)
      • random mutagenesis (44-45)
    Domains in SCOPe 2.08: d1ch0a_
  • Chain 'B':
    Compound: protein (ribonuclease t1)
    Species: Aspergillus oryzae, synthetic [TaxId:5062]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00651 (0-103)
      • see remark 999 (24)
      • random mutagenesis (40-42)
      • random mutagenesis (44-45)
    Domains in SCOPe 2.08: d1ch0b_
  • Chain 'C':
    Compound: protein (ribonuclease t1)
    Species: Aspergillus oryzae, synthetic [TaxId:5062]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00651 (0-103)
      • see remark 999 (24)
      • random mutagenesis (40-42)
      • random mutagenesis (44-45)
    Domains in SCOPe 2.08: d1ch0c_
  • Heterogens: CA, CL, 2GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ch0A (A:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphefrnwqgfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ch0B (B:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphefrnwqgfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ch0C (C:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphefrnwqgfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect