PDB entry 1cgv

View 1cgv on RCSB PDB site
Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glycosyltransferase from bacillus circulans strain 251 affecting activity and product specificity
Deposited on 1994-08-05, released 1995-02-27
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.155
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cgv_ (-)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
    indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
    liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
    tdfsttengiyknlfdladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
    sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
    yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
    gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiaygstqerwinndvli
    yerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllngntlsvgsggaasnf
    tlaaggtavwqytaatatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgad
    itswedtqikvkipavaggnynikvanaagtasnvydnfevlsgdqvsvrfvvnnattal
    gqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvpagktiefkflkkqgstv
    tweggsnhtftapssgtatinvnwqp