PDB entry 1cgu

View 1cgu on RCSB PDB site
Description: catalytic center of cyclodextrin glycosyltransferase derived from x-ray structure analysis combined with site-directed mutagenesis
Class: glycosyltransferase
Keywords: glycosyltransferase
Deposited on 1992-06-10, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.187
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclodextrin glycosyl-transferase
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30920 (0-683)
      • conflict (228)
    Domains in SCOPe 2.07: d1cgua1, d1cgua2, d1cgua3, d1cgua4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cguA (A:)
    dpdtavtnkqsfstdviyqvftdrfldgnpsnnptgaaydatcsnlklycggdwqglink
    indnyfsdlgvtalwisqpvenifatinysgvtntayhgywardfkktnpyfgtmadfqn
    littahakgikividfapnhtspametdtsfaengrlydngtlvggytndtngyfhhngg
    sdfsslengiyknlydladfnhnnatidkyfkdaiklwldmgvdgirvaavkhmplgwqk
    swmssiyahkpvftfgewflgsaasdadntdfanksgmslldfrfnsavrnvfrdntsnm
    yaldsminstatdynqvndqvtfidnhdmdrfktsavnnrrleqalaftltsrgvpaiyy
    gteqyltgngdpdnrakmpsfsksttafnvisklaplrksnpaiaygstqqrwinndvyv
    yerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlngnnitstngsinnft
    laagatavwqyttaettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaai
    tswedtqikvtipsvaagnyavkvaasgvnsnaynnftiltgdqvtvrfvvnnasttlgq
    nlyltgnvaelgnwstgstaigpafnqvihqyptwyydvsvpagkqlefkffkkngstit
    wesgsnhtfttpasgtatvtvnwq