PDB entry 1cgt

View 1cgt on RCSB PDB site
Description: structure of cyclodextrin glycosyltransferase refined at 2.0 angstroms resolution
Class: glycosyltransferase
Keywords: glycosyltransferase
Deposited on 1992-06-10, released 1994-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.166
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclodextrin glycosyl-transferase
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cgta1, d1cgta2, d1cgta3, d1cgta4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cgtA (A:)
    dpdtavtnkqsfstdviyqvftdrfldgnpsnnptgaaydatcsnlklycggdwqglink
    indnyfsdlgvtalwisqpvenifatinysgvtntayhgywardfkktnpyfgtmadfqn
    littahakgikividfapnhtspametdtsfaengrlydngtlvggytndtngyfhhngg
    sdfsslengiyknlydladfnhnnatidkyfkdaiklwldmgvdgirvdavkhmplgwqk
    swmssiyahkpvftfgewflgsaasdadntdfanksgmslldfrfnsavrnvfrdntsnm
    yaldsminstatdynqvndqvtfidnhdmdrfktsavnnrrleqalaftltsrgvpaiyy
    gteqyltgngdpdnrakmpsfsksttafnvisklaplrksnpaiaygstqqrwinndvyv
    yerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlngnnitstngsinnft
    laagatavwqyttaettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaai
    tswedtqikvtipsvaagnyavkvaasgvnsnaynnftiltgdqvtvrfvvnnasttlgq
    nlyltgnvaelgnwstgstaigpafnqvihqyptwyydvsvpagkqlefkffkkngstit
    wesgsnhtfttpasgtatvtvnwq