PDB entry 1cgs

View 1cgs on RCSB PDB site
Description: local and transmitted conformational changes on complexation of an anti-sweetener fab
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-10-06, released 1994-05-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-05-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2b-kappa nc6.8 fab (heavy chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAB16764 (1-213)
      • conflict (4)
      • conflict (18)
      • conflict (30)
      • conflict (36)
      • conflict (38)
      • conflict (47)
      • conflict (56)
      • conflict (58)
      • conflict (60)
      • conflict (65)
      • conflict (96)
      • conflict (98)
      • conflict (100-101)
      • conflict (115)
    Domains in SCOP 1.75: d1cgsh1, d1cgsh2
  • Chain 'L':
    Compound: igg2b-kappa nc6.8 fab (light chain)
    Database cross-references and differences (RAF-indexed):
    • PIR S16112 (2-218)
      • conflict (6)
      • conflict (24)
      • conflict (38)
      • conflict (50)
      • conflict (74)
      • conflict (93)
      • conflict (107)
      • conflict (110)
    Domains in SCOP 1.75: d1cgsl1, d1cgsl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cgsH (H:)
    rvqllesgaelmkpgasvqisckatgytfseywiewvkerpghglewigeilpgsgrtny
    rekfkgkatftadtssntaymqlssltsedsavyyctrgyssmdywgqgtsvtvsaaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cgsL (L:)
    elvmtqsplslpvslgdqasiscrpsqslvhsngntylhwylqkpgqspklliyrvsnrf
    sgvpdrfsgsgsgtaftlkisrveaedlgvyfcsqgthvpytfgggtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec