PDB entry 1cgs

View 1cgs on RCSB PDB site
Description:
Deposited on 1993-10-06, released 1994-05-31
The last revision prior to the SCOP 1.65 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1cgsh1, d1cgsh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1cgsl1, d1cgsl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cgsH (H:)
    rvqllesgaelmkpgasvqisckatgytfseywiewvkerpghglewigeilpgsgrtny
    rekfkgkatftadtssntaymqlssltsedsavyyctrgyssmdywgqgtsvtvsaaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cgsL (L:)
    elvmtqsplslpvslgdqasiscrpsqslvhsngntylhwylqkpgqspklliyrvsnrf
    sgvpdrfsgsgsgtaftlkisrveaedlgvyfcsqgthvpytfgggtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec