PDB entry 1cgq
View 1cgq on RCSB PDB site
Description: macrophage migration inhibitory factor (mif) with alanine inserted between pro-1 and met-2
Class: protein hormone
Keywords: protein hormone, cytokine, enzyme
Deposited on
1999-03-25, released
1999-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (macrophage migration inhibitory factor)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1cgqa_ - Chain 'B':
Compound: protein (macrophage migration inhibitory factor)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1cgqb_ - Chain 'C':
Compound: protein (macrophage migration inhibitory factor)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1cgqc_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1cgqA (A:)
pamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalc
slhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1cgqB (B:)
pamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalc
slhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1cgqC (C:)
pamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalc
slhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa