PDB entry 1cgq

View 1cgq on RCSB PDB site
Description: macrophage migration inhibitory factor (mif) with alanine inserted between pro-1 and met-2
Class: protein hormone
Keywords: protein hormone, cytokine, enzyme
Deposited on 1999-03-25, released 1999-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (macrophage migration inhibitory factor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-114)
      • insertion (1)
    Domains in SCOPe 2.08: d1cgqa_
  • Chain 'B':
    Compound: protein (macrophage migration inhibitory factor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-114)
      • insertion (1)
    Domains in SCOPe 2.08: d1cgqb_
  • Chain 'C':
    Compound: protein (macrophage migration inhibitory factor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-114)
      • insertion (1)
    Domains in SCOPe 2.08: d1cgqc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cgqA (A:)
    pamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalc
    slhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cgqB (B:)
    pamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalc
    slhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cgqC (C:)
    pamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalc
    slhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa