PDB entry 1cgo

View 1cgo on RCSB PDB site
Description: cytochrome c'
Class: electron transport (cytochrome)
Keywords: electron transport (cytochrome)
Deposited on 1995-05-01, released 1995-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Alcaligenes sp. [TaxId:512]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00138 (1-End)
      • conflict (51)
    Domains in SCOPe 2.07: d1cgoa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cgoA (A:)
    efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktltalpwaafg
    pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
    dayrkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cgoA (A:)
    efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktltalpwaafg
    pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
    dayrk