PDB entry 1cgn

View 1cgn on RCSB PDB site
Description: cytochrome c'
Class: electron transport (cytochrome)
Keywords: electron transport (cytochrome)
Deposited on 1995-05-01, released 1995-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.167
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: ACHROMOBACTER XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00138 (1-End)
      • conflict (26)
      • conflict (51)
      • conflict (60)
      • conflict (77)
      • conflict (121)
    Domains in SCOPe 2.07: d1cgna_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cgnA (A:)
    efakpedavkyrqsaltlmashfgrmapvvkgqapydaaqikanvevlktltalpwaafg
    agteggdarpeiwsdaagfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
    dsyrkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cgnA (A:)
    efakpedavkyrqsaltlmashfgrmapvvkgqapydaaqikanvevlktltalpwaafg
    agteggdarpeiwsdaagfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
    dsyrk