PDB entry 1cgm

View 1cgm on RCSB PDB site
Description: structure determination of cucumber green mottle mosaic virus by x-ray fiber diffraction. significance for the evolution of tobamoviruses
Class: virus
Keywords: VIRUS, Helical virus
Deposited on 1993-11-17, released 1994-04-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: FIBER
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Compound: cucumber green mottle mosaic virus
  Species: Cucumber green mottle mosaic virus [TaxId:12235]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19521 (0-159)
  Domains in SCOPe 2.08: d1cgme_
• Chain 'I':
  Compound: RNA (5'-r(p*gp*ap*a)-3')
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cgmE (E:)
  aynpitpskliafsasyvpvrtllnflvasqgtafqtqagrdsfreslsalpssvvdins
  rfpdagfyaflngpvlrpifvsllsstdtrnrvievvdpsnpttaeslnavkrtddasta
  araeidnliesiskgfdvydrasfeaafsvvwseattska
  

  
  
• Chain 'I':
  No sequence available.