PDB entry 1cgl

View 1cgl on RCSB PDB site
Description: structure of the catalytic domain of fibroblast collagenase complexed with an inhibitor
Class: metalloprotease
Keywords: metalloprotease
Deposited on 1993-11-17, released 1995-02-27
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast collagenase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03956 (0-End)
      • conflict (14)
      • conflict (42)
      • conflict (85)
    Domains in SCOP 1.73: d1cgla_
  • Chain 'B':
    Compound: fibroblast collagenase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03956
      • conflict (14)
      • conflict (42)
      • conflict (85)
    Domains in SCOP 1.73: d1cglb_
  • Chain 'C':
    Compound: fibroblast collagenase
  • Chain 'D':
    Compound: fibroblast collagenase
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cglA (A:)
    vltegnprweqthlryrienytpdlpradvdhaiekafqlwsdvtpltftkvsegqadim
    isfvrgdhrdnspfdgpggnlahafdpgpgiggdahfdederwtnnfreynlhrvaahel
    ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cglA (A:)
    vltegnprweqthlryrienytpdlpradvdhaiekafqlwsdvtpltftkvsegqadim
    isfvrgdhrdnspfdgpggnlahafdpgpgiggdahfdederwtnnfreynlhrvaahel
    ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cglB (B:)
    vltegnprweqthlryrienytpdlpradvdhaiekafqlwsdvtpltftkvsegqadim
    isfvrgdhrdnspfdgpggnlahafdpgpgiggdahfdederwtnnfreynlhrvaahel
    ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cglB (B:)
    nprweqthlryrienytpdlpradvdhaiekafqlwsdvtpltftkvqadimisfvrgdh
    rdnspfdgpggnlahafdpgpgiggdahfdederwtnnfreynlhrvaahelghslglsh
    stdigalmypsytfsgdvqlaqddidgiqaiygrsqn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.