PDB entry 1cgl

View 1cgl on RCSB PDB site
Description: structure of the catalytic domain of fibroblast collagenase complexed with an inhibitor
Deposited on 1993-11-17, released 1995-02-27
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cgla_
  • Chain 'B':
    Domains in SCOP 1.55: d1cglb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cglA (A:)
    vltegnprweqthlryrienytpdlpradvdhaiekafqlwsdvtpltftkvsegqadim
    isfvrgdhrdnspfdgpggnlahafdpgpgiggdahfdederwtnnfreynlhrvaahel
    ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cglB (B:)
    nprweqthlryrienytpdlpradvdhaiekafqlwsdvtpltftkvsegqadimisfvr
    gdhrdnspfdgpggnlahafdpgpgiggdahfdederwtnnfreynlhrvaahelghslg
    lshstdigalmypsytfsgdvqlaqddidgiqaiygrsqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cglB (B:)
    nprweqthlryrienytpdlpradvdhaiekafqlwsdvtpltftkvqadimisfvrgdh
    rdnspfdgpggnlahafdpgpgiggdahfdederwtnnfreynlhrvaahelghslglsh
    stdigalmypsytfsgdvqlaqddidgiqaiygrsqn