PDB entry 1cgj

View 1cgj on RCSB PDB site
Description: three-dimensional structure of the complexes between bovine chymotrypsinogen*a and two recombinant variants of human pancreatic secretory trypsin inhibitor (kazal-type)
Class: serine protease/inhibitor complex
Keywords: serine protease/inhibitor complex
Deposited on 1991-10-08, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: alpha-chymotrypsinogen
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cgje_
  • Chain 'I':
    Compound: pancreatic secretory trypsin inhibitor (kazal type) variant 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00995 (0-55)
      • conflict (17-18)
      • conflict (20)
      • conflict (28)
    Domains in SCOPe 2.08: d1cgji_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cgjE (E:)
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cgjI (I:)
dslgreakcynelngctleyrpvcgtdgdtypnecvlcfenrkrqtsiliqksgpc