PDB entry 1cgi

View 1cgi on RCSB PDB site
Description: three-dimensional structure of the complexes between bovine chymotrypsinogen*a and two recombinant variants of human pancreatic secretory trypsin inhibitor (kazal-type)
Class: serine protease/inhibitor complex
Keywords: serine protease/inhibitor complex
Deposited on 1991-10-08, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-09-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: alpha-chymotrypsinogen
    Species: Bos taurus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cgie_
  • Chain 'I':
    Compound: pancreatic secretory trypsin inhibitor (kazal type) variant 3
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00995 (0-55)
      • conflict (17-18)
      • conflict (20)
      • conflict (28)
    Domains in SCOP 1.75: d1cgii_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cgiE (E:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cgiI (I:)
    dslgreakcynelngctyeyrpvcgtdgdtypnecvlcfenrkrqtsiliqksgpc