PDB entry 1cgf

View 1cgf on RCSB PDB site
Description: crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself
Class: hydrolase (metalloprotease)
Keywords: hydrolase (metalloprotease)
Deposited on 1994-02-03, released 1995-03-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cgfa_
  • Chain 'B':
    Compound: fibroblast collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cgfb_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cgfA (A:)
ltegnprweqthlryrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrs

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cgfB (B:)
ltegnprweqthlryrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrs