PDB entry 1cgf

View 1cgf on RCSB PDB site
Description: crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself
Deposited on 1994-02-03, released 1995-03-31
The last revision prior to the SCOP 1.61 freeze date was dated 1995-03-31, with a file datestamp of 1995-03-26.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1cgfa_
  • Chain 'B':
    Domains in SCOP 1.61: d1cgfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cgfA (A:)
    ltegnprweqthlryrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
    sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
    hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cgfB (B:)
    ltegnprweqthlryrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
    sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
    hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrs