PDB entry 1cge

View 1cge on RCSB PDB site
Description: crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself
Deposited on 1994-02-03, released 1995-03-31
The last revision prior to the SCOP 1.59 freeze date was dated 1995-03-31, with a file datestamp of 1995-03-26.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1cge__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cge_ (-)
    ltegnprweqthlryrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
    sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
    hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrs