PDB entry 1cge

View 1cge on RCSB PDB site
Description: crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself
Class: hydrolase (metalloprotease)
Keywords: hydrolase (metalloprotease)
Deposited on 1994-02-03, released 1995-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cgea_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cgeA (A:)
    ltegnprweqthlryrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
    sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
    hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cgeA (A:)
    ltegnprweqthlryrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
    sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
    hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrs