PDB entry 1cg8

View 1cg8 on RCSB PDB site
Description: co form hemoglobin from dasyatis akajei
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1999-03-26, released 1999-04-01
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hemoglobin)
    Species: Dasyatis akajei
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1cg8a_
  • Chain 'B':
    Compound: protein (hemoglobin)
    Species: Dasyatis akajei
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1cg8b_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cg8A (A:)
    vlssqnkkaieelgnlikanaeawgadalarlfelhpqtktyfskfsgfeacneqvkkhg
    krvmnaladathhldnlhlhledlarkhgenllvdphnfhlfadcivvtlavnlqaftpv
    thcavdkflelvayelsscyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cg8B (B:)
    vklsedqehyikgvwkdvdhkqitakalervfvvypwttrlfsklqglfsandigvqqha
    dkvqralgeaiddlkkveinfqnlsgkhqeigvdtqnfkllgqtfmvelalhykktfrpk
    ehaaaykffrlvaealssnyh