PDB entry 1cg8

View 1cg8 on RCSB PDB site
Description:
Deposited on 1999-03-26, released 1999-04-01
The last revision prior to the SCOP 1.71 freeze date was dated 1999-11-03, with a file datestamp of 1999-11-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1cg8a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1cg8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cg8A (A:)
    vlssqnkkaieelgnlikanaeawgadalarlfelhpqtktyfskfsgfeacneqvkkhg
    krvmnaladathhldnlhlhledlarkhgenllvdphnfhlfadcivvtlavnlqaftpv
    thcavdkflelvayelsscyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cg8B (B:)
    vklsedqehyikgvwkdvdhkqitakalervfvvypwttrlfsklqglfsandigvqqha
    dkvqralgeaiddlkkveinfqnlsgkhqeigvdtqnfkllgqtfmvelalhykktfrpk
    ehaaaykffrlvaealssnyh