PDB entry 1cg7

View 1cg7 on RCSB PDB site
Description: hmg protein nhp6a from saccharomyces cerevisiae
Class: DNA binding protein
Keywords: hmg box, DNA bending, DNA recognition, chromatin, nmr, DNA binding protein
Deposited on 1999-03-27, released 1999-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (non histone protein 6 a)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cg7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cg7A (A:)
    mvtprepkkrttrkkkdpnapkralsaymffanenrdivrsenpditfgqvgkklgekwk
    altpeekqpyeakaqadkkryesekelynatla