PDB entry 1cg6

View 1cg6 on RCSB PDB site
Description:
Deposited on 1999-03-27, released 1999-07-05
The last revision prior to the SCOP 1.65 freeze date was dated 2000-05-23, with a file datestamp of 2000-05-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.202
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1cg6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cg6A (A:)
    masgttttavkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllar
    hgrqhtimpskvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmr
    pqsfydgshscargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssr
    aesfmfrtwgadvinmttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktl
    kenankakslllttipqigstewsetlhnlknmaqfsvllprh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cg6A (A:)
    avkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhgrqhtim
    pskvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgs
    hscargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrt
    wgadvinmttvpevvlakeagicyasiamatdydcwavsvdrvlktlkenankakslllt
    tipqigstewsetlhnlknmaqfsvllp