PDB entry 1cg5

View 1cg5 on RCSB PDB site
Description: deoxy form hemoglobin from dasyatis akajei
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1999-03-26, released 1999-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hemoglobin)
    Species: Dasyatis akajei [TaxId:31902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cg5a_
  • Chain 'B':
    Compound: protein (hemoglobin)
    Species: Dasyatis akajei [TaxId:31902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cg5b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cg5A (A:)
    vlssqnkkaieelgnlikanaeawgadalarlfelhpqtktyfskfsgfeacneqvkkhg
    krvmnaladathhldnlhlhledlarkhgenllvdphnfhlfadcivvtlavnlqaftpv
    thcavdkflelvayelsscyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cg5B (B:)
    vklsedqehyikgvwkdvdhkqitakalervfvvypwttrlfsklqglfsandigvqqha
    dkvqralgeaiddlkkveinfqnlsgkhqeigvdtqnfkllgqtfmvelalhykktfrpk
    ehaaaykffrlvaealssnyh