PDB entry 1cg4

View 1cg4 on RCSB PDB site
Description: structure of the mutant (r303l) of adenylosuccinate synthetase from e. coli complexed with, GDP, 6-phosphoryl-imp, and mg2+
Class: ligase
Keywords: ligase, GTP-hydrolysing enzymes, purine 2 nucleotide biosynthesis, 6-phosporyl-imp
Deposited on 1999-03-26, released 1999-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (adenylosuccinate synthetase)
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7D4 (0-430)
      • mutation (302)
    Domains in SCOPe 2.07: d1cg4a_
  • Heterogens: MG, IMO, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cg4A (A:)
    gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
    renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
    rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
    vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
    snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
    tglrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
    aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
    etmilrdpfda