PDB entry 1cfz

View 1cfz on RCSB PDB site
Description: hydrogenase maturating endopeptidase hybd from e. coli
Class: hydrogenase
Keywords: hydrogenase, maturation, metzincins, nickel, protease
Deposited on 1999-03-23, released 2000-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydrogenase 2 maturation protease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cfza_
  • Chain 'B':
    Compound: hydrogenase 2 maturation protease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cfzb_
  • Chain 'C':
    Compound: hydrogenase 2 maturation protease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cfzc_
  • Chain 'D':
    Compound: hydrogenase 2 maturation protease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cfzd_
  • Chain 'E':
    Compound: hydrogenase 2 maturation protease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cfze_
  • Chain 'F':
    Compound: hydrogenase 2 maturation protease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cfzf_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfzA (A:)
    mrilvlgvgnilltdeaigvrivealeqryilpdyveildggtagmellgdmanrdhlii
    adaivskknapgtmmilrdeevpalftnkisphqlgladvlsalrftgefpkkltlvgvi
    peslephigltptveamiepaleqvlaalresgveaiprsds
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfzB (B:)
    mrilvlgvgnilltdeaigvrivealeqryilpdyveildggtagmellgdmanrdhlii
    adaivskknapgtmmilrdeevpalftnkisphqlgladvlsalrftgefpkkltlvgvi
    peslephigltptveamiepaleqvlaalresgveaiprsds
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfzC (C:)
    mrilvlgvgnilltdeaigvrivealeqryilpdyveildggtagmellgdmanrdhlii
    adaivskknapgtmmilrdeevpalftnkisphqlgladvlsalrftgefpkkltlvgvi
    peslephigltptveamiepaleqvlaalresgveaiprsds
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfzD (D:)
    mrilvlgvgnilltdeaigvrivealeqryilpdyveildggtagmellgdmanrdhlii
    adaivskknapgtmmilrdeevpalftnkisphqlgladvlsalrftgefpkkltlvgvi
    peslephigltptveamiepaleqvlaalresgveaiprsds
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfzE (E:)
    mrilvlgvgnilltdeaigvrivealeqryilpdyveildggtagmellgdmanrdhlii
    adaivskknapgtmmilrdeevpalftnkisphqlgladvlsalrftgefpkkltlvgvi
    peslephigltptveamiepaleqvlaalresgveaiprsds
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfzF (F:)
    mrilvlgvgnilltdeaigvrivealeqryilpdyveildggtagmellgdmanrdhlii
    adaivskknapgtmmilrdeevpalftnkisphqlgladvlsalrftgefpkkltlvgvi
    peslephigltptveamiepaleqvlaalresgveaiprsds