PDB entry 1cfy

View 1cfy on RCSB PDB site
Description: yeast cofilin, monoclinic crystal form
Deposited on 1996-11-26, released 1997-04-01
The last revision prior to the SCOP 1.55 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.175
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cfya_
  • Chain 'B':
    Domains in SCOP 1.55: d1cfyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfyA (A:)
    vavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclya
    iydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfs
    evsydsvlervsr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfyB (B:)
    vavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclya
    iydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfs
    evsydsvlervsr