PDB entry 1cfw

View 1cfw on RCSB PDB site
Description: ga-substituted desulforedoxin
Class: electron transport
Keywords: rubredoxin type protein, electron transport
Deposited on 1999-03-22, released 1999-07-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (desulforedoxin)
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cfwa_
  • Chain 'B':
    Compound: protein (desulforedoxin)
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cfwb_
  • Heterogens: GA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfwA (A:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfwB (B:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq