PDB entry 1cfs

View 1cfs on RCSB PDB site
Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated peptide
Class: polyspecificity
Keywords: polyspecificity, cross reactivity, fab-fragment, peptide, hiv-1
Deposited on 1999-03-19, released 1999-03-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.232
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (igg2a kappa antibody cb41 (light chain))
    Species: Mus musculus
    Domains in SCOP 1.75: d1cfsa1, d1cfsa2
  • Chain 'B':
    Compound: protein (igg2a kappa antibody cb41 (heavy chain))
    Species: Mus musculus
    Domains in SCOP 1.75: d1cfsb1, d1cfsb2
  • Chain 'C':
    Compound: protein (antigen bound peptide)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfsA (A:)
    dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
    rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlkradaaptvsifpp
    sseqltsggasvvcflnnfypkeinvkwkidgserqngvldswteqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfsB (B:)
    qdqlqqsgaelvrpgasvklsckalgyiftdyeihwvkqtpvhglewiggihpgssgtay
    nqkfkgkatltadkssttafmelssltsedsavyyctrkdywgqgtlvtvsaakttapsv
    yplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsglytlsssv
    tvtsntwpsqtitcnvahpasstkvdkkieprv
    

  • Chain 'C':
    No sequence available.