PDB entry 1cfr

View 1cfr on RCSB PDB site
Description: crystal structure of citrobacter freundii restriction endonuclease cfr10i at 2.15 angstroms resolution.
Class: restriction endonuclease
Keywords: restriction endonuclease, restriction enzyme
Deposited on 1996-02-02, released 1997-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.196
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: restriction endonuclease
    Species: Citrobacter freundii [TaxId:546]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cfra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cfrA (A:)
    mdiisksgegnkytinsaiafvayashidinttefskvlsglrdfindeairlggkisdg
    sfnkcngdwyewligiraiefflesetnfivvkmpnatsfdvmsiyksclsefiydlrsk
    lslnnvnlitsnpdfsiidirgrreelksmlkdisfsnislstiseidnlyknfidyael
    ehiksflsvkttfrpdrrlqlahegslmkalythlqtrtwtinptgiryyaaatsignad
    viglktvathsitdvkslpqsavdeifkinsvldvdsclshilss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cfrA (A:)
    mdiisksgegnkytinsaiafvayashidinttefskvlsglrdfindeairlggkisdg
    sfnkcngdwyewligiraiefflesetnfivvkmpnatsfdvmsiyksclsefiydlrsk
    lslnnvnlitsnpdfsiidirgrreelksmlkdisfsnislstiseidnlyknfidyael
    ehiksflsvkttfrpdrrlqlahegslmkalythlqtrtwtinptgiryyaaatsignad
    viglktvathsitdvkslpqsavdeifkinsvldvdsclshil