PDB entry 1cfp

View 1cfp on RCSB PDB site
Description: s100b (s100beta) nmr data was collected from a sample of calcium free protein at ph 6.3 and a temperature of 311 k and 1.7-6.9 mm concentration, 25 structures
Class: calcium-binding protein
Keywords: helix-loop-helix, calcium-binding protein
Deposited on 1996-06-04, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: s100b
  Species: Bos taurus, synthetic [TaxId:9913]
  Gene: S100B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02638 (1-91)
  Domains in SCOPe 2.08: d1cfpa_
• Chain 'B':
  Compound: s100b
  Species: Bos taurus, synthetic [TaxId:9913]
  Gene: S100B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02638 (1-91)
  Domains in SCOPe 2.08: d1cfpb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cfpA (A:)
  mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
  ldsdgdgecdfqefmafvamittacheffehe
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cfpB (B:)
  mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
  ldsdgdgecdfqefmafvamittacheffehe