PDB entry 1cfo

View 1cfo on RCSB PDB site
Description: cytochrome c551.5, nmr, 20 structures
Deposited on 1996-08-01, released 1997-06-16
The last revision was dated 1997-06-16, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: 0.19
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: HEC

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1cfo_ (-)
advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik

  • Chain 'p':
    No sequence available.