PDB entry 1cfn

View 1cfn on RCSB PDB site
Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-related peptide
Class: polyspecificity
Keywords: polyspecificity, cross reactivity, fab-fragment, peptide, hiv-1
Deposited on 1999-03-19, released 1999-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.277
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (igg2a kappa antibody cb41 (light chain))
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.07: d1cfna1, d1cfna2
  • Chain 'B':
    Compound: protein (igg2a-kappa antibody cb41 (heavy chain))
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.07: d1cfnb1, d1cfnb2
  • Chain 'C':
    Compound: protein (bound peptide)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfnA (A:)
    dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
    rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlkradaaptvsifpp
    sseqltsggasvvcflnnfypkeinvkwkidgserqngvldswteqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfnB (B:)
    qdqlqqsgaelvrpgasvklsckalgyiftdyeihwvkqtpvhglewiggihpgssgtay
    nqkfkgkatltadkssttafmelssltsedsavyyctrkdywgqgtlvtvsaakttapsv
    yplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsglytlsssv
    tvtsntwpsqtitcnvahpasstkvdkkieprv
    

  • Chain 'C':
    No sequence available.