PDB entry 1cfm

View 1cfm on RCSB PDB site
Description: cytochrome f from chlamydomonas reinhardtii
Class: electron transport
Keywords: cytochrome f, plastocyanin, proton wire, heme, electron transport
Deposited on 1998-09-18, released 1999-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome f
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cfma1, d1cfma2
  • Chain 'B':
    Compound: cytochrome f
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cfmb1, d1cfmb2
  • Chain 'C':
    Compound: cytochrome f
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cfmc1, d1cfmc2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfmA (A:)
    ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
    langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
    kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnntiynasaagkiv
    aitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpltnnpnvggfgqa
    eteivlqnpar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfmB (B:)
    ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
    langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
    kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnntiynasaagkiv
    aitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpltnnpnvggfgqa
    eteivlqnpar
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfmC (C:)
    ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
    langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
    kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnntiynasaagkiv
    aitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpltnnpnvggfgqa
    eteivlqnpar