PDB entry 1cfe

View 1cfe on RCSB PDB site
Description: p14a, nmr, 20 structures
Class: pathogenesis-related protein
Keywords: pathogenesis-related protein, pr-1 proteins, plant defense
Deposited on 1996-11-08, released 1997-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pathogenesis-related protein p14a
    Species: Solanum lycopersicum [TaxId:4081]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cfea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfeA (A:)
    qnspqdylavhndaraqvgvgpmswdanlasraqnyansragdcnlihsgagenlakggg
    dftgraavqlwvserpsynyatnqcvggkkcrhytqvvwrnsvrlgcgrarcnngwwfis
    cnydpvgnwigqrpy