PDB entry 1cfa

View 1cfa on RCSB PDB site
Description: solution structure of a semi-synthetic c5a receptor antagonist at ph 5.2, 303k, nmr, 20 structures
Class: Immune system/INHIBITOR
Keywords: COMPLEMENT FACTOR, COMPLEMENT ALTERNATE PATHWAY, GLYCOPROTEIN, AGGREGATION INHIBITOR, GP ANTAGONIST, COMPLEMENT FACTOR-PEPTIDE complex, Immune system-INHIBITOR complex
Deposited on 1996-09-21, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement 5a semi-synthetic antagonist
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01031 (0-70)
      • cloning artifact (26)
    Domains in SCOPe 2.07: d1cfaa_
  • Chain 'B':
    Compound: synthetic n-terminal tail
    Database cross-references and differences (RAF-indexed):
    • PDB 1CFA (0-3)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfaA (A:)
    mlqkkieeiaakykhsvvkkccydgasvnndetceqraarislgprcikafteccvvasq
    lranishkdmc
    

  • Chain 'B':
    No sequence available.