PDB entry 1cf9

View 1cf9 on RCSB PDB site
Description: Structure of the mutant VAL169CYS of catalase HPII from Escherichia coli
Class: oxidoreductase
Keywords: hydrogen peroxide, oxidoreductase, covalent modifications
Deposited on 1999-03-24, released 1999-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (catalase hpii)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (26-752)
      • mutation (168)
    Domains in SCOPe 2.07: d1cf9a1, d1cf9a2
  • Chain 'B':
    Compound: protein (catalase hpii)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (26-752)
      • mutation (168)
    Domains in SCOPe 2.07: d1cf9b1, d1cf9b2
  • Chain 'C':
    Compound: protein (catalase hpii)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (26-752)
      • mutation (168)
    Domains in SCOPe 2.07: d1cf9c1, d1cf9c2
  • Chain 'D':
    Compound: protein (catalase hpii)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (26-752)
      • mutation (168)
    Domains in SCOPe 2.07: d1cf9d1, d1cf9d2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cf9A (A:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstcqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf9A (A:)
    dslapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgv
    riaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsd
    itkadflsdpnkitpvfvrfstcqggagsadtvrdirgfatkfyteegifdlvgnntpif
    fiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsy
    rtmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweai
    eagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaen
    eqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrd
    gmhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyys
    hprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgiel
    tddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkak
    gvhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylm
    eaykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsrip
    kidkipa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cf9B (B:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstcqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf9B (B:)
    dslapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgv
    riaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsd
    itkadflsdpnkitpvfvrfstcqggagsadtvrdirgfatkfyteegifdlvgnntpif
    fiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsy
    rtmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweai
    eagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaen
    eqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrd
    gmhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyys
    hprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgiel
    tddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkak
    gvhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylm
    eaykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsrip
    kidkipa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cf9C (C:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstcqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf9C (C:)
    dslapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgv
    riaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsd
    itkadflsdpnkitpvfvrfstcqggagsadtvrdirgfatkfyteegifdlvgnntpif
    fiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsy
    rtmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweai
    eagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaen
    eqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrd
    gmhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyys
    hprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgiel
    tddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkak
    gvhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylm
    eaykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsrip
    kidkipa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cf9D (D:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstcqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf9D (D:)
    dslapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgv
    riaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsd
    itkadflsdpnkitpvfvrfstcqggagsadtvrdirgfatkfyteegifdlvgnntpif
    fiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsy
    rtmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweai
    eagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaen
    eqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrd
    gmhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyys
    hprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgiel
    tddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkak
    gvhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylm
    eaykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsrip
    kidkipa