PDB entry 1cf8

View 1cf8 on RCSB PDB site
Description: Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions
Class: catalytic antibody
Keywords: catalytic antibody, terpenoid synthase, carbocation, cyclization cascade
Deposited on 1999-03-24, released 1999-07-28
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-24, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.165
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (catalytic antibody 19a4 (heavy chain))
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1cf8h1, d1cf8h2
  • Chain 'L':
    Compound: protein (catalytic antibody 19a4 (light chain))
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1cf8l1, d1cf8l2
  • Heterogens: CD, HAZ, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cf8H (H:)
    dvqlqesgpglvkpsqslsltctvtgysitsgyawnwirqfpgnklewmgyirysgdtry
    npslksrisitrdtsknqfflqlnsvttedtatyycaigygnsdywgqgtlvtvsaaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhafpallqsdlytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklepkdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cf8L (L:)
    divltqsptimsvspgekvtltcsasssvssnyvywyqqkpgsspkvwiystsnlasgvp
    arfsgsgsgtsysltissmeaedaasyfclqwssfpytfgggtklelkradvaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec