PDB entry 1cf8

View 1cf8 on RCSB PDB site
Description: Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions
Deposited on 1999-03-24, released 1999-07-28
The last revision prior to the SCOP 1.71 freeze date was dated 1999-09-07, with a file datestamp of 1999-09-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.165
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cf8H (H:)
    dvqlqesgpglvkpsqslsltctvtgysitsgyawnwirqfpgnklewmgyirysgdtry
    npslksrisitrdtsknqfflqlnsvttedtatyycaigygnsdywgqgtlvtvsaaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhafpallqsdlytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklepkdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cf8L (L:)
    divltqsptimsvspgekvtltcsasssvssnyvywyqqkpgsspkvwiystsnlasgvp
    arfsgsgsgtsysltissmeaedaasyfclqwssfpytfgggtklelkradvaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec