PDB entry 1cf7

View 1cf7 on RCSB PDB site
Description: structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp
Deposited on 1999-03-24, released 1999-04-02
The last revision prior to the SCOP 1.65 freeze date was dated 2000-04-10, with a file datestamp of 2000-04-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1cf7a_
  • Chain 'B':
    Domains in SCOP 1.65: d1cf7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cf7A (A:)
    ppgtpsrhekslgllttkfvsllqeakdgvldlklaadtlavrqkrriyditnvlegigl
    iekksknsiqwkgvgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf7A (A:)
    srhekslgllttkfvsllqeakdgvldlklaadtlavrqkrriyditnvlegigliekks
    knsiqwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cf7B (B:)
    rskkgdkngkglrhfsmkvcekvqrkgttsynevadelvseftnsnnhlaadsaydqkni
    rrrvydalnvlmamniiskekkeikwiglptnsaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf7B (B:)
    gkglrhfsmkvcekvqrkgttsynevadelvseftnsnnhlaadsaydqknirrrvydal
    nvlmamniiskekkeikwiglp