PDB entry 1cf4

View 1cf4 on RCSB PDB site
Description: cdc42/ack gtpase-binding domain complex
Class: transferase
Keywords: cdc42/ack gtpase complex, g protein, transferase
Deposited on 1999-03-23, released 1999-06-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cdc42 homolog)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (0-183)
      • conflict (60)
    Domains in SCOPe 2.08: d1cf4a_
  • Chain 'B':
    Compound: protein (activated p21cdc42hs kinase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07912 (0-43)
      • conflict (0-1)
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cf4A (A:)
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
ledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkk

  • Chain 'B':
    No sequence available.