PDB entry 1cf3

View 1cf3 on RCSB PDB site
Description: glucose oxidase from apergillus niger
Class: oxidoreductase(flavoprotein)
Keywords: oxidoreductase(flavoprotein)
Deposited on 1999-03-23, released 1999-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glucose oxidase)
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cf3a1, d1cf3a2
  • Heterogens: NAG, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cf3A (A:)
    sngieaslltdpkdvsgrtvdyiiagggltglttaarltenpnisvlviesgsyesdrgp
    iiedlnaygdifgssvdhayetvelatnnqtalirsgnglggstlvnggtwtrphkaqvd
    swetvfgnegwnwdnvaayslqaerarapnakqiaaghyfnaschgvngtvhagprdtgd
    dyspivkalmsavedrgvptkkdfgcgdphgvsmfpntlhedqvrsdaarewllpnyqrp
    nlqvltgqyvgkvllsqngttpravgvefgthkgnthnvyakhevllaagsavsptiley
    sgigmksileplgidtvvdlpvglnlqdqttatvrsritsagagqgqaawfatfnetfgd
    ysekahellntkleqwaeeavarggfhnttalliqyenyrdwivnhnvayselfldtagv
    asfdvwdllpftrgyvhildkdpylhhfaydpqyflneldllgqaaatqlarnisnsgam
    qtyfagetipgdnlaydadlsawteyipyhfrpnyhgvgtcsmmpkemggvvdnaarvyg
    vqglrvidgsipptqmsshvmtvfyamalkisdailedyasmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf3A (A:)
    gieaslltdpkdvsgrtvdyiiagggltglttaarltenpnisvlviesgsyesdrgpii
    edlnaygdifgssvdhayetvelatnnqtalirsgnglggstlvnggtwtrphkaqvdsw
    etvfgnegwnwdnvaayslqaerarapnakqiaaghyfnaschgvngtvhagprdtgddy
    spivkalmsavedrgvptkkdfgcgdphgvsmfpntlhedqvrsdaarewllpnyqrpnl
    qvltgqyvgkvllsqngttpravgvefgthkgnthnvyakhevllaagsavsptileysg
    igmksileplgidtvvdlpvglnlqdqttatvrsritsagagqgqaawfatfnetfgdys
    ekahellntkleqwaeeavarggfhnttalliqyenyrdwivnhnvayselfldtagvas
    fdvwdllpftrgyvhildkdpylhhfaydpqyflneldllgqaaatqlarnisnsgamqt
    yfagetipgdnlaydadlsawteyipyhfrpnyhgvgtcsmmpkemggvvdnaarvygvq
    glrvidgsipptqmsshvmtvfyamalkisdailedyasmq