PDB entry 1cf2

View 1cf2 on RCSB PDB site
Description: three-dimensional structure of d-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic archaeon methanothermus fervidus
Class: oxidoreductase
Keywords: oxydoreductase
Deposited on 1999-03-24, released 2000-03-24
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: protein (glyceraldehyde-3-phosphate dehydrogenase)
    Species: Methanothermus fervidus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cf2o1, d1cf2o2
  • Chain 'P':
    Compound: protein (glyceraldehyde-3-phosphate dehydrogenase)
    Species: Methanothermus fervidus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cf2p1, d1cf2p2
  • Chain 'Q':
    Compound: protein (glyceraldehyde-3-phosphate dehydrogenase)
    Species: Methanothermus fervidus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cf2q1, d1cf2q2
  • Chain 'R':
    Compound: protein (glyceraldehyde-3-phosphate dehydrogenase)
    Species: Methanothermus fervidus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cf2r1, d1cf2r2
  • Heterogens: SO4, NAP, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1cf2O (O:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnilq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf2O (O:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnil
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1cf2P (P:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnilq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf2P (P:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnil
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1cf2Q (Q:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnilq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf2Q (Q:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnil
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1cf2R (R:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnilq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf2R (R:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnil