PDB entry 1cf2

View 1cf2 on RCSB PDB site
Description: three-dimensional structure of d-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic archaeon methanothermus fervidus
Deposited on 1999-03-24, released 2000-03-24
The last revision prior to the SCOP 1.67 freeze date was dated 2000-03-24, with a file datestamp of 2000-03-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1cf2O (O:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnilq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf2O (O:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnil
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1cf2P (P:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnilq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf2P (P:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnil
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1cf2Q (Q:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnilq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf2Q (Q:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnil
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1cf2R (R:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnilq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cf2R (R:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnil