PDB entry 1cez

View 1cez on RCSB PDB site
Description: crystal structure of a T7 RNA polymerase-T7 promoter complex
Class: transferase/DNA
Keywords: T7 RNA polymerase, transferase/DNA complex
Deposited on 1999-03-11, released 1999-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.224
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (bacteriophage T7 RNA polymerase)
    Species: Enterobacteria phage T7 [TaxId:10760]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ceza_
  • Chain 'N':
    Compound: DNA (5'-d(p*tp*ap*ap*tp*ap*cp*gp*ap*cp*tp*cp*ap*cp*tp*a)-3')
  • Chain 'T':
    Compound: DNA (5'-d(p*tp*ap*tp*ap*gp*tp*gp*ap*gp*tp*cp*gp*tp*ap*tp*tp*a)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cezA (A:)
    mntiniakndfsdielaaipfntladhygerlareqlalehesyemgearfrkmferqlk
    agevadnaaakplittllpkmiarindwfeevkakrgkrptafqflqeikpeavayitik
    ttlacltsadnttvqavasaigraiedearfgrirdleakhfkknveeqlnkrvghvykk
    afmqvveadmlskgllggeawsswhkedsihvgvrciemliestgmvslhrqnagvvgqd
    setielapeyaeaiatragalagispmfqpcvvppkpwtgitgggywangrrplalvrth
    skkalmryedvympevykainiaqntawkinkkvlavanvitkwkhcpvedipaiereel
    pmkpedidmnpealtawkraaaavyrkdkarksrrislefmleqankfanhkaiwfpynm
    dwrgrvyavsmfnpqgndmtkglltlakgkpigkegyywlkihgancagvdkvpfperik
    fieenhenimacaksplentwwaeqdspfcflafcfeyagvqhhglsyncslplafdgsc
    sgiqhfsamlrdevggravnllpsetvqdiygivakkvneilqadaingtdnevvtvtde
    ntgeisekvklgtkalagqwlaygvtrsvtkrsvmtlaygskefgfrqqvledtiqpaid
    sgkglmftqpnqaagymakliwesvsvtvvaaveamnwlksaakllaaevkdkktgeilr
    krcavhwvtpdgfpvwqeykkpiqtrlnlmflgqfrlqptintnkdseidahkqesgiap
    nfvhsqdgshlrktvvwahekygiesfalihdsfgtipadaanlfkavretmvdtyescd
    vladfydqfadqlhesqldkmpalpakgnlnlrdilesdfafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cezA (A:)
    iakndfsdielaaipfntladhygerlareqlalehesyemgearfrkmfplittllpkm
    iarindwfeevkakrgkrptafqflqeikpeavayitikttlacltsadnttvqavasai
    graiedearfgrirdleakhfkknveeqlnkrvghvykkafmqvveadmlskgllggeaw
    sswhkedsihvgvrciemliestgmvslhrqnagvvgqdsetielapeyaeaiatragal
    agispmfqpcvvppkpwtgitgggywangrrplalvrthskkalmryedvympevykain
    iaqntawkinkkvlavanvitkwkhcpvedipaiereelpmkpedidmnpealtawkraa
    aavyrkdkarksrrislefmleqankfanhkaiwfpynmdwrgrvyavsmfnpqgndmtk
    glltlakgkpigkegyywlkihgancagvdkvpfperikfieenhenimacaksplentw
    waeqdspfcflafcfeyagvqhhglsyncslplafdgscsgiqhfsamlrdevggravnl
    lpsetvqdiygivakkvneilqadaingtdnevvtvtdentgeisekvklgtkalagqwl
    aygvtrsvtkrsvmtlaygskefgfrqqvledtiqpaidsgkglmftqpnqaagymakli
    wesvsvtvvaaveamnwlksaakllaaevkdkktgeilrkrcavhwvtpdgfpvwqeykk
    piqtrlnlmflgqfrlqptintnkdseidahkqesgiapnfvhsqdgshlrktvvwahek
    ygiesfalihdsfgtipadaanlfkavretmvdtyescdvladfydqfadqlhesqldkm
    palpakgnlnlrdilesdfafa
    

  • Chain 'N':
    No sequence available.

  • Chain 'T':
    No sequence available.