PDB entry 1cew

View 1cew on RCSB PDB site
Description: the 2.0 angstroms x-ray crystal structure of chicken egg white cystatin and its possible mode of interaction with cysteine proteinases
Class: proteinase inhibitor(cysteine)
Keywords: proteinase inhibitor(cysteine)
Deposited on 1993-04-21, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'I':
  Compound: cystatin
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01038 (0-107)
  Domains in SCOPe 2.08: d1cewi_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cewI (I:)
  gapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqveigr
  ttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq