PDB entry 1cev

View 1cev on RCSB PDB site
Description: arginase from bacillus caldovelox, native structure at ph 5.6
Class: hydrolase
Keywords: enzyme, hydrolase, arginine hydrolysis, nitrogen metabolism, manganese metalloenzyme
Deposited on 1999-03-12, released 1999-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (arginase)
    Species: Bacillus caldovelox [TaxId:33931]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ceva_
  • Chain 'B':
    Compound: protein (arginase)
    Species: Bacillus caldovelox [TaxId:33931]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cevb_
  • Chain 'C':
    Compound: protein (arginase)
    Species: Bacillus caldovelox [TaxId:33931]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cevc_
  • Chain 'D':
    Compound: protein (arginase)
    Species: Bacillus caldovelox [TaxId:33931]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cevd_
  • Chain 'E':
    Compound: protein (arginase)
    Species: Bacillus caldovelox [TaxId:33931]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ceve_
  • Chain 'F':
    Compound: protein (arginase)
    Species: Bacillus caldovelox [TaxId:33931]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cevf_
  • Heterogens: MN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cevA (A:)
    mkpisiigvpmdlgqtrrgvdmgpsamryagvierlerlhydiedlgdipigkaerlheq
    gdsrlrnlkavaeaneklaaavdqvvqrgrfplvlggdhsiaigtlagvakhyerlgviw
    ydahgdvntaetspsgnihgmplaaslgfghpaltqiggyspkikpehvvligvrsldeg
    ekkfirekgikiytmhevdrlgmtrvmeetiaylkertdgvhlsldldgldpsdapgvgt
    pviggltyreshlamemlaeaqiitsaefvevnpildernktasvavalmgslfgeklm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cevB (B:)
    mkpisiigvpmdlgqtrrgvdmgpsamryagvierlerlhydiedlgdipigkaerlheq
    gdsrlrnlkavaeaneklaaavdqvvqrgrfplvlggdhsiaigtlagvakhyerlgviw
    ydahgdvntaetspsgnihgmplaaslgfghpaltqiggyspkikpehvvligvrsldeg
    ekkfirekgikiytmhevdrlgmtrvmeetiaylkertdgvhlsldldgldpsdapgvgt
    pviggltyreshlamemlaeaqiitsaefvevnpildernktasvavalmgslfgeklm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cevC (C:)
    mkpisiigvpmdlgqtrrgvdmgpsamryagvierlerlhydiedlgdipigkaerlheq
    gdsrlrnlkavaeaneklaaavdqvvqrgrfplvlggdhsiaigtlagvakhyerlgviw
    ydahgdvntaetspsgnihgmplaaslgfghpaltqiggyspkikpehvvligvrsldeg
    ekkfirekgikiytmhevdrlgmtrvmeetiaylkertdgvhlsldldgldpsdapgvgt
    pviggltyreshlamemlaeaqiitsaefvevnpildernktasvavalmgslfgeklm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cevD (D:)
    mkpisiigvpmdlgqtrrgvdmgpsamryagvierlerlhydiedlgdipigkaerlheq
    gdsrlrnlkavaeaneklaaavdqvvqrgrfplvlggdhsiaigtlagvakhyerlgviw
    ydahgdvntaetspsgnihgmplaaslgfghpaltqiggyspkikpehvvligvrsldeg
    ekkfirekgikiytmhevdrlgmtrvmeetiaylkertdgvhlsldldgldpsdapgvgt
    pviggltyreshlamemlaeaqiitsaefvevnpildernktasvavalmgslfgeklm
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cevE (E:)
    mkpisiigvpmdlgqtrrgvdmgpsamryagvierlerlhydiedlgdipigkaerlheq
    gdsrlrnlkavaeaneklaaavdqvvqrgrfplvlggdhsiaigtlagvakhyerlgviw
    ydahgdvntaetspsgnihgmplaaslgfghpaltqiggyspkikpehvvligvrsldeg
    ekkfirekgikiytmhevdrlgmtrvmeetiaylkertdgvhlsldldgldpsdapgvgt
    pviggltyreshlamemlaeaqiitsaefvevnpildernktasvavalmgslfgeklm
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cevF (F:)
    mkpisiigvpmdlgqtrrgvdmgpsamryagvierlerlhydiedlgdipigkaerlheq
    gdsrlrnlkavaeaneklaaavdqvvqrgrfplvlggdhsiaigtlagvakhyerlgviw
    ydahgdvntaetspsgnihgmplaaslgfghpaltqiggyspkikpehvvligvrsldeg
    ekkfirekgikiytmhevdrlgmtrvmeetiaylkertdgvhlsldldgldpsdapgvgt
    pviggltyreshlamemlaeaqiitsaefvevnpildernktasvavalmgslfgeklm